Il-6 and il-6-receptor derived peptides having il-6 antagonistic or agonistic activity

摘要

The invention relates to IL-6 and IL-6-receptor derived peptides having IL-6 agonistic or antagonistic activity. The peptides are at least 5 amino acids long and are selected from one of the following amino acid sequences: RYILDGISALRK, STKVLIQFLQKKAKNL, ILRSFKEFLQSSLRALRQMQLSCFRKSPLSNVVC, PRSTPSLTTKAVLLVRKFQNS, MCVASSVGSKFSKTQTFQGC, PEKPKNLSCIVNEGKKMRCEWDGGR, NFTLKSEWATHKFADCKAKRDTPTS, WVEAENALGKVTSDH, EWGPRSTPSLTTKAVLLVRKFQNSPAED or PVYKVKPNPPHNLSVIN. Selected peptides and combinations of selected peptides can be used in the treatment, prevention, detection, or diagnosis of IL-6 related disease and can be used to clear blood or bloodproducts of IL-6 or IL-6 receptor molecules.