Polypeptides encoding DCMP1 and DCMP2, including a fusion polypeptide of both DCMP1 and DCMP2 and antibodies thereof

摘要

A substantially pure or recombinant dendritic cell membrane proteins (DCMP) having similarity with lectins and asialoghycoprotein receptors with at least 10 contiguous amino acid residues as shown in Seq ID 2 or Seq ID 8 is described. Methods of producing recombinant polypeptides and diagnostic methods thereof are described. The polypeptides are useful as markers, and may function in controlling development, differentiation and physiology of the mammalian immune system. Seq ID 2 MTSEITYAEVRFKNEFKSSGINTASSAASKERTAPL KSNTGFPKLLCASLLIFFLLLAISFFIAFVIFFQKYSQ LLEKKTTKELVHTTLECVKKNMPVEETAWS Seq ID 8 CTKSVSPMEDKVWSCCPKDWRLFGSHCYLVPTVSS SASWNKSEENCSRMGAHLVVIQSQEEQDFITGILDT HAAYFIGLWDTGHRQWQWVDQTPYEESITFWHNG EPSSGNEKCATIIYRWKTGWGWNDISCSLKQKSVC QMKKINL