Polypeptide coded by the Kaposi sarcoma-associated virus (KSHV, HHV-8) and its uses in diagnostic and therapy

摘要

New polypeptide is a fragment of at least 10 consecutive amino acids (aa) from sequence (1): (MSSTQIRTEIPVALLILCLCLVACHA)nNCPTYRSHLGFWQEGWSGQVYQDWLGRMNCSYENMTALEAV SLNGTRLAAGSPSSEYPNVSVSVEDTSASGSGEDAIDESGSGEEERPVTSHVT FMTQSVQATTELTDALISAFSGVLHVSTVIPRNWVNRRCVGIKRNLTFCLIYRIIFIWGTIQDHANSRIT GRRKRQK (1) n = 0 or 1. Also new are: (1) a nucleic acid construct (II), particularly a vector, containing at least 30 consecutive nucleotides (nt) from a sequence given in the specification that encodes (1; n =1); (2) antibodies (Ab) directed against (I); and (3) kits for detection of Kaposi sarcoma-associated herpes virus (KSHV).