PHARMACEUTICAL COMPOSITION OF ANTIBODY COMPLEX AGAINST DIGOXYGENIN AND DIGOXIGENIN CONJUGATED WITH PEPTIDE

摘要

1. A pharmaceutical composition comprising a complex of: a) a monospecific antibody that binds to digoxigenin, and b) digoxigenin, wherein digoxigenin is conjugated to a peptide consisting of 5-60 amino acids. The pharmaceutical composition according to claim 1, wherein the peptide contains from 10 to 50 amino acids. The pharmaceutical composition of claim 1, wherein the antibody of claim a) is a monoclonal antibody. The pharmaceutical composition according to claim 1, wherein the antibody according to a) comprises a heavy chain variable domain with the sequence of SEQ ID NO: 37 and a light chain variable domain with the sequence of SEQ ID NO: 36.5. The pharmaceutical composition of claim 1, wherein the antibody of claim a) is a humanized antibody or a human antibody. The pharmaceutical composition according to claim 5, wherein the antibody according to a) comprises a heavy chain variable domain with the sequence of SEQ ID NO: 39 and a light chain variable domain with the sequence of SEQ ID NO: 38.7. The pharmaceutical composition according to claim 1, characterized in that the peptide is selected from the group consisting of: Ac-IK-Pqa-RHYLNWVTRQ (N-methyl) RY (SEQ ID NO: 26); GIGAVLKVLTTGLPALISWIKRKRQQ (SEQ ID NO: 32); FALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES (SEQ ID NO: 33); NKRFALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPR (SEQ ID NO: 34); and QHRYQQLGAGLKVLFKKTHRILRRLFNLAK (SEQ ID NO: 35) .8. Complex: a) a monospecific antibody that binds to digoxigenin, and b) digoxigenin, with digoxigenin conjugated to a peptide consisting of 5-60 amino acids, and the complex was recovered after preparation. 9. The complex of claim 8, wherein the peptide contains from 10 to 50 amino acids. The complex of claim 8, wherein the antibody of claim a) is a monoclonal antibody. 11. The complex of claim 8, wherein the antibody of claim a) contains the variable domain of the heavy chain with the sequence of SEQ ID NO: 1 and �