Novel method for recovering and applying human defensin as a bioactive protein for use in the treatment of infectious and other diseases

摘要

Peptides (I) of the defensin type, are new. New peptides (I) have formula (F1). ZN-C-X m-X 1-X-C-X 2-X n-C-X-X-X-X 3-XO-C-X p-C-C-ZC (F1) ZN and ZC : 1 - 30 amino acid (aa) residues; X : any aa; X many 3 - 6 aa; X n2 - 3 aa; X o5 - 9 aa; X p4 - 6 aa; X 1G, A or P; X 2R, K, W, Q or A; X 3E or H. Independent claims are also included for the following: (1) cyclic, amidated, acetylated, sulfated, phosphorylated, glycosylated and oxidized derivatives and fragments of (I), with similar biological activity; (2) methods for preparing (I), their derivatives or fragments; and (3) nucleic acid (II) that encodes one or more of (I), their derivatives or fragments. ACTIVITY : Antibacterial; antiinfertility; contraceptive. The peptide designated hBD17 TPGGTQRCWNLYGKCRYRCSKKERVYVYCINNKMCCVKPKYQPKERWWPF was positive in a radial diffusion test against Escherichia coli, Staphylococcus carnosusand Saccharomyces cerevisiae, and against S. carnosushad MIC below 25 Microg/ml. MECHANISM OF ACTION : Peptide therapy.