A therapeutic agent for cognitive impairment and a therapeutic agent for Alzheimer's disease induced by amyloid β protein, and a therapeutic method and a pathological condition analysis method related thereto

摘要

An object of the present invention is to provide an anti-Alzheimer agent having an amyloid β protein as a mechanism of action, but different from the conventional mechanism of action. The therapeutic agent for Alzheimer's disease according to the present invention comprises a peptide comprising the amino acid sequence represented by SEQ ID NO: 1 or a similar peptide, particularly a peptide comprising the amino acid sequence represented by SEQ ID NO: 2 which is a partial sequence of SEQ ID NO: 1. It contains a therapeutic agent for cognitive impairment induced by the amyloid β protein contained therein, and the therapeutic agent. VLSSQQFLHRGHQPPPEMAGHSLASSHRNSMIPSAAT (SEQ ID NO: 1) HRHGHQPPPEMA (SEQ ID NO: 2)