Enhanced reconstituted surfactant composition containing surfactant protein B (SP-B) and surfactant protein C (SP-C) analogues

摘要

A reconstituted surfactant composition comprising: a) 1.2 to 1.8% by weight of a native SP-C surfactant protein polypeptide analog consisting of the sequence represented by the formula IPSSPVHLKRLKLLLLLLLLILLLILGALLLGL (SEQ ID NO: 1) ; b) 0.1 to 0.5% by weight of a native SP-B surfactant protein polypeptide analog consisting of the sequence represented by the formula CWLCRALIKRIQALIPKGGRLLPQLVCRLVLRCS (SEQ ID NO: 2); c) a monounsaturated phospholipid and a saturated phospholipid in a weight ratio ranging from 45:55 to 55:45; wherein said monounsaturated phospholipid is selected from the group consisting of palmitoyloleylphosphatidylcholine (POFC) and palmitoylolethylphosphatidylglycerol (POFG), and wherein said saturated phospholipid is selected from the group consisting of dipalmitoylphosphatidylcholine (DPFC) and dipal phosphol (DPFC); all amounts being calculated in relation to the total weight of the reconstituted surfactant.