Immunologically active proteins of Borrelia burgdorferi, nucleic acids coding for them as well as their use in test kits and as vaccines

摘要

The present invention relates to immunologically active proteins from Borrelia burgdorferi which are present in a form which is free of other proteins derived from Borrelia burgdorferi and which exhibit the sequence of the protein 1829-22A, which has the amino acid sequenceMKKFNLIIEALFAILLTACNFGLMEETKIALESSSKDVKNKILQIKKDAEDKGVNFAAFTSSETG SKVTNGGLALREAKIQAINEVEKFLKRIEEEALKLKEHGNSGQFLELFDLLLEVLESLEPIGIKG LKDFISEEAKCNPISTSERLIEVKVQIENKMEEVKRKQNLNKERKSNKGKKKK SEQ. ID NO.: 1or a part sequence thereof having at least 10 consecutive amino acids, or exhibit the sequence of the protein 1829-22B, which has the amino acid sequenceMIKYNKIILTLTLLASLLAACSLTGKARLESSVKDITNEIEKAIKEAEDAGVKTDAFTETQTGGK VAGPKIRAAKIRVADLTIKFLEATEEETITFKENGAGEDEFSGIYDLILNAAKAVEKIGMKDMTK TVEEAAKENPKTTANGIIEIVKVMKAKVENIKEKQTKNQK SEQ. ID NO.: 2or a part sequence thereof having at least 10 consecutive amino acids.