Fusion peptide intended for inhibition of the interaction of a neural NMDA receptor (NMDAR) with protein interacting with NMDAR

摘要

1. A fusion peptide containing at least component (I), where component (I) is a transporting peptide and component (II) selected from peptides having the ability to inhibit the interaction of a neural N-methyl-D-aspartate receptor (NMDAR) with interacting with NMDAR proteins, where component (II) consists entirely of D-enantiomeric amino acids. ! 2. The fusion peptide according to claim 1, in which component (I) is selected from peptides that have the ability to penetrate into the cell, including:! (a) protein transduction domains (PTDs) and derived from CPP protein, including sequences derived from the genome of flies carrying the Antennapedia mutation, pAntp (43-58), which contain the sequences RQIKIWFQNRRMKWKK (SEQ ID NO: 1) or RQIKIWFQNRRMKKKK SEQ ID NO: 2); including sequences derived from human immunodeficiency virus 1 (HIV-1), Tat, region 37-72, region 37-60, region 48-60 or region 49-57 from TAT, sequences GRKKRRQRRR (SEQ ID NO: 3), YGRKKRRQRRR (SEQ ID NO: 4), CGRKKRRQRRRRPPQC (SEQ ID NO: 5) or CGRKKRRQRRRRPPQCC (SEQ ID NO: 6); including hCT (9-32) having the sequence LGTYTQDFNKFHTFPQTAIGVGAP-NH2 (SEQ ID NO: 7); pVEC containing the sequence LLIILRRRIRKQAHAHSK-NH2 (SEQ ID NO: 8); pISL containing the sequence RVIRVWFQNKRCKDKK-NH2 (SEQ ID NO: 9); murine PRP (1-28) containing the sequence MANGLYWLLALFVTMWTDVGLCKKRPKP-NH2 (SEQ ID NO: 10) or their homologues, including human homologues; Ems (194-220) containing the sequence RQGAARVTSWLGLQLRIAGKRLEGRSK-NH2 (SEQ ID NO: 11); Restricocin L3 (60-73) containing the sequence KLIKGRTPIKFGK-NH2 (SEQ ID NO: 12) or! (b) model peptides, including VT5, containing the sequence DPKGDPKGVTVTVTVTVTGKGDPKPD-NH2 (SEQ ID NO: 13), a MAP containing the sequence KLALKLALKALKAALKLA-NH2 (SEQ ID NO: 14), arginine segments, including RRRRRRR, i.e. (Arg) 7 (SEQ ID NO: 15), or RRRRRRRR-NH2, i.e. (Arg) 7-NH2 (SEQ ID NO: 16), or RRRRRRRR-C, i.e. (